IGF-1 DES

$69.99
Bulk Discounts
  • Buy 1 - 2 and get 1% off
  • Buy 3 - 5 and get 3% off
  • Buy 6 - 9 and get 5% off
  • Buy 10 - 20 and get 10% off
  • Buy 21 - 50 and get 20% off

Warning
THIS PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY .IT IS FOR RESEARCH USE ONLY, NOT FOR HUMAN CONSUMPTION!


Basic Information

IGF-1 DES

Quantity:

1mg

Purity:

>98% by HPLC

CAS NO.:

112603-35-7

Molecular Formula:

C319H501N91O96S7

Molecular Weight:

7,372 Da

Appearance:

Sterile filtered white lyophilized (freeze-dried) powder

AA Sequence:

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA 

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to settle the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.

Storage:

This lyophilized preparation is stable at room temperature when garded from light, but should be kept at -20°C for long term storage, preferably with dessicant. Upon reconstitution, the preparation is stable when stored at 2-8°C. For maximum stability, apportion the reconstituted preparation into working aliquots and store at -20°C. Avoid repeat freeze/thaw cycles.


More Information

IGF-1 DES is a naturally occurring, endogenous protein, as well as drug, and truncated analogue of insulin-like growth factor 1 (IGF-1).[1][2][3][4] des(1-3)IGF-1 lacks the first three amino acids at the N-terminus of IGF-1 (for a total of 67 amino acids, relative to the 70 of IGF-1).[5] As a result of this difference, it has considerably reduced binding to the insulin-like growth factor-binding proteins (IGFBPs) and enhanced potency (about 10-fold in vivo) relative to IGF-1.The amino acid sequence of des(1-3)IGF-1 is TLCGAELVDA LQFVCGDRGF YFNKPTGYGS SSRRAPQTGI VDECCFRSCD LRRLEMYCAP LKPAKSA.The products we offer are intended for laboratory research use only.The Products we sold on our store are not been used as drugs, agricultural or pesticidal products, food additives or household chemicals.

IGF-1 DES HPLC Purity Test Report

Write a Review

Your Rating *

Bulk Discounts
  • Buy 1 - 2 and get 1% off
  • Buy 3 - 5 and get 3% off
  • Buy 6 - 9 and get 5% off
  • Buy 10 - 20 and get 10% off
  • Buy 21 - 50 and get 20% off
IGF-1 DES